PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00144.1.g00210.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 434aa    MW: 48115.2 Da    PI: 9.5289
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00144.1.g00210.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF55.48e-181150342
                                  --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
                        SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                                  i n+s r  tf kRr+g++KKA+EL +LCd++++v+ +++
  Zpz_sc00144.1.g00210.1.am.mk 11 IVNDSTRRATFKKRRKGLMKKASELATLCDVDACVVAYGE 50
                                  7799**********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.0E-21160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006617.731150IPR002100Transcription factor, MADS-box
CDDcd002664.43E-32285No hitNo description
SuperFamilySSF554557.46E-24395IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-9323IPR002100Transcription factor, MADS-box
PfamPF003191.7E-171150IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-92338IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-93859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0043078Cellular Componentpolar nucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 434 aa     Download sequence    Send to blast
MARKKVTLQW IVNDSTRRAT FKKRRKGLMK KASELATLCD VDACVVAYGE GESQPEVWPS  60
VAEAARVLAR FKAMPELDQC KKMMDMEGFL KQRIDKLREQ LHKAQRENRE RETTLLLHDS  120
IVGRRPGLVG LSIEELTSLG SMTDERLQNV NKALENLQAQ GGQGLPVTAL QLQLSQAASM  180
TLPPLVTYPA PGVGQRDVQA PPNMQCWMMD VPKPGGELGA MLYGGGFDGG STQQGFDGAG  240
SFTAGGHMTQ LGNMGAGFQW PDPGQSFPPI SDGKLDCLDR YVWLNLIDTR RTIGELVPVT  300
AGIKTALLAW KAERPDRGFV LNVVKSPVFV RLRLVSHARE QAGSSLRRRE GERSSFRRAA  360
GSEVMAGRWR RDENPFEEGE GDVNPFSIMY FVGFALFTLE ALLSIWVMQQ VYRYFRGKGH  420
EAAMRPDAAA RPPF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVTLQWIVNDSTRRATFKKRR
22125KKRRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00553DAPTransfer from AT5G48670Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7277161e-144KJ727716.1 Zea mays clone pUT5655 MADS transcription factor (MADS64) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008646559.11e-106PREDICTED: agamous-like MADS-box protein AGL80
TrEMBLA0A060D1451e-106A0A060D145_MAIZE; MADS transcription factor (Fragment)
STRINGGRMZM5G853066_P011e-105(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36336202
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.12e-39AGAMOUS-like 80